PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr004311.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 1001aa    MW: 112411 Da    PI: 5.0675
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr004311.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.11e-13853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
      Pbr004311.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.7e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
      Pbr004311.1  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.3E-131070No hitNo description
CDDcd001674.27E-121053No hitNo description
SuperFamilySSF466898.63E-2133106IPR009057Homeodomain-like
CDDcd116598.49E-3155106No hitNo description
Gene3DG3DSA:1.10.10.603.3E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118313.1E-52443675IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1001 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACVKD ENYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIPFEKKPP PGFYDVADED RPVEQPNFPT  240
TIEELEGKRR IDVEAQLRKQ DIAKNKIARK RRIDVEAHLR KQDIAKNKIA QRQDAPSAIL  300
QANKMNDPET VRKRSKLMLP APQISDNELE EIAKMGYAND LAVEEFAEGS GATRALLANY  360
SQTPRLGMTP SRTPQRTPAG KGDAIMMEAE NLARMRESQT PLLGGDNPEL HPSDFSGVTP  420
RKKEIQTPNL MLTPSATPGG GLTPRTGLTP RVGMTPSRDS FGMTPKGTPI RDELRINEEI  480
DTPNSAKLEQ RRNLQFGFGS LPQPKNEYQI VVQPVPEDTE EPEEKIEEDM SDRLARERAE  540
EEARQQALLR KRSKVLQREL PRPPAASLDL IRNSLIKADG DRSSFVPPTP IEQADEMVKV  600
ELLSLLEHDN AKYPFTEKVD KRKKKGSKRS ANGPTSSVPV IEDFEEDELK EADSLIKEDA  660
EILRVAMRHE NESLDEFVEA HKTCLNDLMY FPTRGAYGLS SVAGNMEKLA ALQSEFENVK  720
KKMDDDIQKA ASIENKVKVR TYGYEMRVKE GLWPKIEETF KQIDTAAKEL ECFKALQKQE  780
RLAATHRINN IWEEVQNQKE LERQLQKRYG NLVVEVERGQ RRMDELRTEA EKQEIAARNS  840
DLELAEATAN VTVQQTTENP DPVTASDEPG NAVPGGASDG EATNQQMDGV QEQASTGPEG  900
DMDIDAKKVH ATPADDVNLP DNMPSAVEGD SVSDNVVASE NLKVNDPDVS KDQKVEMPQN  960
VTEIEGTIQA AGDDGFANGT AEIVSVEGDV NSTENAAPQI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10332242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364449.10.0PREDICTED: cell division cycle 5-like protein isoform X3
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLM5WK140.0M5WK14_PRUPE; Uncharacterized protein
STRINGGLYMA20G36600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5